ADCY2, Mouse, Clone: 1D4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ADCY2.

Supplier:  Abnova Corporation H00000108M01

Catalog No. 89-016-049

Description

This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq]

Sequence: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS

Specifications

• Antigen: ADCY2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020546
• Gene Symbols: ADCY2
• Immunogen: ADCY2 (NP_065433, 977 a.a. ∼ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, In situ PLA
• Clone: 1D4
• Description: Mouse monoclonal antibody raised against a partial recombinant ADCY2.
• Gene: ADCY2
• Gene Alias: AC2/FLJ16822/FLJ45092/HBAC2/KIAA1060/MGC133314
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 108
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid