Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

adenylate cyclase 5, Mouse, Clone: 3E6, Abnova™

Catalog No. 89014043 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-043 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-043 Supplier Abnova Corporation Supplier No. H00000111M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ADCY5.

ADCY5 belongs to the adenylate cyclase (EC 4.6.1.1) family of enzymes responsible for the synthesis of cAMP (Ludwig and Seuwen, 2002 [PubMed 12503609]).[supplied by OMIM

Sequence: ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS

Specifications

Antigen adenylate cyclase 5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ADCY5.
Formulation PBS with no preservative; pH 7.4
Gene ADCY5
Gene Accession No. NM_183357
Gene Alias AC5
Gene Symbols ADCY5
Host Species Mouse
Immunogen ADCY5 (NP_899200, 1152 a.a. ∼ 1261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Endocrine/Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 111
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.