ADCYAP1R1, Mouse, Clone: 2B12, Abnova™

Catalog No.	Quantity
89-016-050	100 μg

Catalog No. 89-016-050 Supplier Abnova Corporation Supplier No. H00000117M01

Description

Mouse monoclonal antibody raised against a partial recombinant ADCYAP1R1.

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Alternative splicing of two exons of this gene generates four major splice variants, but their full-length nature has not been determined. [provided by RefSeq

Sequence: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE

Specifications

• Antigen: ADCYAP1R1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ADCYAP1R1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ADCYAP1R1
• Gene Accession No.: NM_001118
• Gene Alias: PAC1/PACAPR/PACAPRI
• Gene Symbols: ADCYAP1R1
• Host Species: Mouse
• Immunogen: ADCYAP1R1 (NP_001109, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 117
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ