ADH1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-213	50 μL

Catalog No. 89-003-213 Supplier Abnova Corporation Supplier No. H00000124A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADH1A.

This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. [provided by RefSeq

Sequence: DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF

Specifications

• Antigen: ADH1A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADH1A.
• Formulation: 50% glycerol
• Gene: ADH1A
• Gene Accession No.: NM_000667
• Gene Alias: ADH1
• Gene Symbols: ADH1A
• Host Species: Mouse
• Immunogen: ADH1A (NP_000658, 298 a.a. ∼ 375 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 124
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid