Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADH4, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ADH4.

Manufacturer:  Abnova Corporation H00000127M03A

Catalog No. 89-016-054


  Check Availability
Add to cart

Specifications

Description

This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq

Sequence: SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS
Description & Specifications

Specifications

ADH4
1D2
alcohol dehydrogenase 4 (class II), pi polypeptide
ADH4
Ascites
ADH4
ADH4 (NP_000661, 52 a.a. ∽151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In ascites fluid
NM_000670
ADH-2
Murine
IgG2a, κ
RUO
Primary
127
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit