ADH4, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ADH4.

Manufacturer: Abnova Corporation H00000127M03A

Catalog No. 89-016-054

  Check Availability
Add to Cart

    Specifications

    Antigen ADH4
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 1D2
    Conjugate Unlabeled
    Cross Reactivity Human
    Description alcohol dehydrogenase 4 (class II), pi polypeptide
    Format Ascites
    Formulation In ascites fluid
    Gene ADH4
    Gene Accession No. NM_000670
    Gene Alias ADH-2
    Gene Symbols ADH4
    Host Species Mouse
    Immunogen ADH4 (NP_000661, 52 a.a. ∽151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 127

    This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq

    Sequence: SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit