ADH4, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ADH4.

Manufacturer:  Abnova Corporation H00000127M03A

Catalog No. 89-016-054

Description

This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq

Sequence: SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS

See Product Certificates

Specifications

• Antigen: ADH4
• Clone: 1D2
• Description: alcohol dehydrogenase 4 (class II), pi polypeptide
• Gene: ADH4
• Format: Ascites
• Gene Symbols: ADH4
• Immunogen: ADH4 (NP_000661, 52 a.a. ∽151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
• Quantity: 200μL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Monoclonal or Polyclonal: Monoclonal
• Target Species: Human

• Applications: ELISA,Western Blot
• Conjugate: Unlabeled
• Formulation: In ascites fluid
• Gene Accession No.: NM_000670
• Gene Alias: ADH-2
• Host Species: Murine
• Isotype: IgG2a, κ
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 127