alcohol dehydrogenase 5 (class III), chi polypeptide, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-008	50 μL

Catalog No. 89-004-008 Supplier Abnova Corporation Supplier No. H00000128A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADH5.

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several nontranscribed pseudogenes related to this gene. [provided by RefSeq

Sequence: KLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAP

Specifications

• Antigen: alcohol dehydrogenase 5 (class III), chi polypeptide
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADH5.
• Formulation: 50% glycerol
• Gene: ADH5
• Gene Accession No.: NM_000671
• Gene Alias: ADH-3/ADHX/FDH/GSNOR
• Gene Symbols: ADH5
• Host Species: Mouse
• Immunogen: ADH5 (NP_000662, 82 a.a. ∼ 165 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 128
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum