adenosine kinase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-009	50 μL

Catalog No. 89-004-009 Supplier Abnova Corporation Supplier No. H00000132A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADK.

This gene encodes adenosine kinase, an abundant enzyme in mammalian tissues. The enzyme catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Alternative splicing results in two transcript variants encoding different isoforms. Both isoforms of the enzyme phosphorylate adenosine with identical kinetics and both require Mg2+ for activity. [provided by RefSeq]

Sequence: FETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH

Specifications

• Antigen: Adenosine Kinase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADK.
• Formulation: 50% glycerol
• Gene: ADK
• Gene Accession No.: NM_001123
• Gene Alias: AK
• Gene Symbols: ADK
• Host Species: Mouse
• Immunogen: ADK (NP_001114, 236 a.a. ∼ 345 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Endocrine/Metabolism
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 132
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum