ADORA2A, Mouse, Clone: 4E4, Abnova™

Catalog No.	Quantity
89-123-136	100 μg

Catalog No. 89-123-136 Supplier Abnova Corporation Supplier No. H00000135M17

Description

Mouse monoclonal antibody raised against a partial recombinant ADORA2A.

This gene encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. [provided by RefSeq

Sequence: GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL

Specifications

• Antigen: ADORA2A
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 4E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ADORA2A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ADORA2A
• Gene Accession No.: NM_000675.3
• Gene Alias: ADORA2/RDC8/hA2aR
• Gene Symbols: ADORA2A
• Host Species: Mouse
• Immunogen: ADORA2A (NP_000666.2, 147 a.a. ∼ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 135
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ