AGC1, Mouse, Clone: 2A8, Abnova™

Catalog No.	Quantity
89-016-064	100 μg

Catalog No. 89-016-064 Supplier Abnova Corporation Supplier No. H00000176M01

Description

Mouse monoclonal antibody raised against a partial recombinant AGC1.

This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene. [provided by RefSeq

Sequence: PMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVF

Specifications

• Antigen: AGC1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AGC1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACAN
• Gene Accession No.: NM_013227
• Gene Alias: AGC1/AGCAN/CSPG1/CSPGCP/MSK16/SEDK
• Gene Symbols: ACAN
• Host Species: Mouse
• Immunogen: AGC1 (NP_037359, 56 a.a. ∼ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 176
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ