1-acylglycerol-3-phosphate O-acyltransferase 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AGPAT3.

Supplier:  Abnova Corporation H00056894A01

Catalog No. 89-004-686

Description

The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP

Specifications

• Antigen: 1-acylglycerol-3-phosphate O-acyltransferase 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant AGPAT3.
• Gene: AGPAT3
• Gene Alias: LPAAT-GAMMA1/MGC4604
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 56894
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_020132
• Gene Symbols: AGPAT3
• Immunogen: AGPAT3 (NP_064517, 155 a.a. ∼ 259 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum