Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anterior gradient homolog 2 (Xenopus laevis), Mouse, Clone: 1C3, Abnova™

Catalog No. 89014264 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-264 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-264 Supplier Abnova Corporation Supplier No. H00010551M03
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant AGR2.

Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Specifications

Antigen anterior gradient homolog 2 (Xenopus laevis)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1C3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant AGR2.
Formulation PBS with no preservative; pH 7.4
Gene AGR2
Gene Accession No. BC015503
Gene Alias AG2/GOB-4/HAG-2/XAG-2
Gene Symbols AGR2
Host Species Mouse
Immunogen AGR2 (AAH15503.1, 1 a.a. ∼ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10551
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.