AHR, Mouse, Clone: 3B1, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant AHR.

Supplier:  Abnova Corporation H00000196M07

Catalog No. 89-016-081

Description

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. [provided by RefSeq

Sequence: EIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRP

Specifications

• Antigen: AHR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001621
• Gene Symbols: AHR
• Immunogen: AHR (NP_001612, 279 a.a. ∼ 376 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA
• Clone: 3B1
• Description: Mouse monoclonal antibody raised against a full length recombinant AHR.
• Gene: AHR
• Gene Alias: bHLHe76
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 196
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid