Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000509

aryl hydrocarbon receptor, Mouse, Clone: 3H4, Abnova™

Catalog No. 89000509 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-509 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-509 Supplier Abnova Corporation Supplier No. H00000196M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant AHR.

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. [provided by RefSeq

Sequence: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN

Specifications

Antigen aryl hydrocarbon receptor
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3H4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AHR.
Formulation PBS with no preservative; pH 7.4
Gene AHR
Gene Accession No. NM_001621
Gene Alias bHLHe76
Gene Symbols AHR
Host Species Mouse
Immunogen AHR (NP_001612, 721 a.a. ∼ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 196
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.