AK1, Mouse, Clone: 4C2-1A8, Abnova™

Catalog No.	Quantity
89-016-089	100 μg

Catalog No. 89-016-089 Supplier Abnova Corporation Supplier No. H00000203M07

Description

Mouse monoclonal antibody raised against a full-length recombinant AK1.

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq

Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Specifications

• Antigen: AK1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4C2-1A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant AK1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AK1
• Gene Accession No.: BC001116
• Gene Symbols: AK1
• Host Species: Mouse
• Immunogen: AK1 (AAH01116, 1 a.a. ∼ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 203
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ