AK2, Mouse, Clone: 3F1, Abnova™

Catalog No.	Quantity
89-016-091	100 μg

Catalog No. 89-016-091 Supplier Abnova Corporation Supplier No. H00000204M01

Description

Mouse monoclonal antibody raised against a full-length recombinant AK2.

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Specifications

• Antigen: AK2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3F1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant AK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AK2
• Gene Accession No.: BC009405
• Gene Alias: ADK2
• Gene Symbols: AK2
• Host Species: Mouse
• Immunogen: AK2 (AAH09405, 1 a.a. ∼ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 204
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ