A kinase (PRKA) anchor protein 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AKAP1.

Supplier:  Abnova Corporation H00008165A01

Catalog No. 89-004-383

Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq

Sequence: VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL

Specifications

• Antigen: A kinase (PRKA) anchor protein 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant AKAP1.
• Gene: AKAP1
• Gene Alias: AKAP/AKAP121/AKAP149/AKAP84/D-AKAP1/MGC1807/PRKA1/SAKAP84
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 8165
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003488
• Gene Symbols: AKAP1
• Immunogen: AKAP1 (NP_003479, 806 a.a. ∼ 903 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum