A kinase (PRKA) anchor protein 13, Mouse, Clone: 3D6, Abnova™

Catalog No.	Quantity
89-001-211	100 μg

Catalog No. 89-001-211 Supplier Abnova Corporation Supplier No. H00011214M10

Description

Mouse monoclonal antibody raised against a partial recombinant AKAP13.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternative splicing of this gene results in at least 3 transcript variants encoding different isoforms containing a dbl oncogene homology (DH) domain and a pleckstrin homology (PH) domain. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, resulting in the conversion of the inactive GTPase to the active form capable of transducing signals. The PH domain has multiple functions. Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway and, in addition, function as protein kinase A-anchoring proteins. [provided by RefSeq

Sequence: MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ

Specifications

• Antigen: A kinase (PRKA) anchor protein 13
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AKAP13.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AKAP13
• Gene Accession No.: NM_006738
• Gene Alias: AKAP-Lbc/ARHGEF13/BRX/FLJ11952/FLJ43341/HA-3/Ht31/LBC/PROTO-LB/PROTO-LBC/c-lbc
• Gene Symbols: AKAP13
• Host Species: Mouse
• Immunogen: AKAP13 (NP_006729, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11214
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ