AKR1B1, Mouse, Clone: 2D12, Abnova™

Catalog No.	Quantity
89-016-119	100 μg

Catalog No. 89-016-119 Supplier Abnova Corporation Supplier No. H00000231M03

Description

Mouse monoclonal antibody raised against a full-length recombinant AKR1B1.

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq

Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

Specifications

• Antigen: AKR1B1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2D12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant AKR1B1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AKR1B1
• Gene Accession No.: BC000260.1
• Gene Alias: ADR/ALDR1/ALR2/AR/MGC1804
• Gene Symbols: AKR1B1
• Host Species: Mouse
• Immunogen: AKR1B1 (AAH00260.1, 1 a.a. ∼ 316 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 231
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ