Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004690

aldo-keto reductase family 1, member B10 (aldose reductase), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004690 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-690 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-690 Supplier Abnova Corporation Supplier No. H00057016A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant AKR1B10.

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq

Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE

Specifications

Antigen aldo-keto reductase family 1, member B10 (aldose reductase)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant AKR1B10.
Formulation 50% glycerol
Gene AKR1B10
Gene Accession No. NM_020299
Gene Alias AKR1B11/AKR1B12/ALDRLn/ARL-1/ARL1/HIS/HSI/MGC14103
Gene Symbols AKR1B10
Host Species Mouse
Immunogen AKR1B10 (NP_064695, 76 a.a. ∼ 143 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 57016
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.