Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AKR1C2, Mouse, Clone: 3C11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AKR1C2.

Manufacturer:  Abnova Corporation H00001646M03A

Catalog No. 89-021-278


  Check Availability
Add to cart

Specifications

Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq

Sequence: EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPVSDEY
Description & Specifications

Specifications

AKR1C2
3C11
Human
Ascites
AKR1C2
AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
In ascites fluid
BC063574
AKR1C2
AKR1C2 (AAH63574, 224 a.a. ∽324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
200μL
Human
Primary
1646
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit