AKR1C2, Mouse, Clone: 3C11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AKR1C2.

Manufacturer: Abnova Corporation H00001646M03A

Catalog No. 89-021-278

  Check Availability
Add to Cart

    Specifications

    Antigen AKR1C2
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3C11
    Conjugate Unlabeled
    Cross Reactivity Human
    Description aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
    Format Ascites
    Formulation In ascites fluid
    Gene AKR1C2
    Gene Accession No. BC063574
    Gene Alias AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2
    Gene Symbols AKR1C2
    Host Species Mouse
    Immunogen AKR1C2 (AAH63574, 224 a.a. ∽324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1646

    This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq

    Sequence: EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPVSDEY

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit