AKT1, Mouse, Clone: 3E11, Abnova™

Catalog No.	Quantity
89-016-099	100 μg

Catalog No. 89-016-099 Supplier Abnova Corporation Supplier No. H00000207M26

Description

Mouse monoclonal antibody raised against a partial recombinant AKT1.

The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

Specifications

• Antigen: AKT1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AKT1
• Gene Accession No.: BC000479
• Gene Alias: AKT/MGC99656/PKB/PKB-ALPHA/PRKBA/RAC/RAC-ALPHA
• Gene Symbols: AKT1
• Host Species: Mouse
• Immunogen: AKT1 (AAH00479, 381 a.a. ∼ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 207
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ