v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma), Mouse, Clone: 6E10, Abnova™

Catalog No.	Quantity
89-014-247	100 μg

Catalog No. 89-014-247 Supplier Abnova Corporation Supplier No. H00010000M02

Description

Mouse monoclonal antibody raised against a partial recombinant AKT3.

The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE

Specifications

• Antigen: v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6E10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AKT3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AKT3
• Gene Accession No.: AF124141
• Gene Alias: DKFZp434N0250/PKB-GAMMA/PKBG/PRKBG/RAC-PK-gamma/RAC-gamma/STK-2
• Gene Symbols: AKT3
• Host Species: Mouse
• Immunogen: AKT3 (AAD29089, 100 a.a. ∼ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Gene ID (Entrez): 10000
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ