ALAS1, Mouse, Clone: 3G10, Abnova™

Catalog No.	Quantity
89-016-103	100 μg

Catalog No. 89-016-103 Supplier Abnova Corporation Supplier No. H00000211M01

Description

Mouse monoclonal antibody raised against a partial recombinant ALAS1.

Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300).[supplied by OMIM

Sequence: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP

Specifications

• Antigen: ALAS1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ALAS1
• Gene Accession No.: NM_000688
• Gene Alias: ALAS/ALAS3/ALASH/MIG4
• Gene Symbols: ALAS1
• Host Species: Mouse
• Immunogen: ALAS1 (NP_000679, 1 a.a. ∼ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 211
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ