ALAS2, Mouse, Clone: 4D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ALAS2.

Supplier:  Abnova Corporation H00000212M02

Catalog No. 89-016-105

Description

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK

Specifications

• Antigen: ALAS2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000032
• Gene Symbols: ALAS2
• Immunogen: ALAS2 (NP_000023, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 4D8
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS2.
• Gene: ALAS2
• Gene Alias: ALAS-E/ALASE/ANH1/ASB/FLJ93603/XLSA
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 212
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid