Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014045

aminolevulinate, delta-, synthase 2, Mouse, Clone: 6C1, Abnova™

Catalog No. 89014045 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-045 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-045 Supplier Abnova Corporation Supplier No. H00000212M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ALAS2.

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK

Specifications

Antigen aminolevulinate, delta-, synthase 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6C1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALAS2.
Formulation PBS with no preservative; pH 7.4
Gene ALAS2
Gene Accession No. NM_000032
Gene Alias ALAS-E/ALASE/ANH1/ASB/FLJ93603/XLSA
Gene Symbols ALAS2
Host Species Mouse
Immunogen ALAS2 (NP_000023, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 212
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.