Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89015850

aldehyde dehydrogenase 1 family, member L1, Mouse, Clone: 3E9, Abnova™

Catalog No. 89015850 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-015-850 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-015-850 Supplier Abnova Corporation Supplier No. H00010840M01

Description

Mouse monoclonal antibody raised against a partial recombinant ALDH1L1.

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. [provided by RefSeq

Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY

Specifications

Antigen aldehyde dehydrogenase 1 family, member L1
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 3E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALDH1L1.
Formulation PBS with no preservative; pH 7.4
Gene ALDH1L1
Gene Accession No. NM_012190
Gene Alias DKFZp781N0997/FTHFD
Gene Symbols ALDH1L1
Host Species Mouse
Immunogen ALDH1L1 (NP_036322, 803 a.a. ∼ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10840
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.