ALDH3B2, Mouse, Clone: 3E6, Abnova™

Catalog No.	Quantity
89-016-114	100 μg

Catalog No. 89-016-114 Supplier Abnova Corporation Supplier No. H00000222M01

Description

Mouse monoclonal antibody raised against a full-length recombinant ALDH3B2.

This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq

Sequence: MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL

Specifications

• Antigen: ALDH3B2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ALDH3B2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ALDH3B2
• Gene Accession No.: BC007685
• Gene Alias: ALDH8
• Gene Symbols: ALDH3B2
• Host Species: Mouse
• Immunogen: ALDH3B2 (AAH07685, 1 a.a. ∼ 385 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 222
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ