Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016115

ALDH9A1, Mouse, Clone: 3C6, Abnova™

Catalog No. 89016115 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-115 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-115 Supplier Abnova Corporation Supplier No. H00000223M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ALDH9A1.

This protein belongs to the aldehyde dehydrogenase family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54kDa subunits. [provided by RefSeq

Sequence: CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN

Specifications

Antigen ALDH9A1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3C6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALDH9A1.
Formulation PBS with no preservative; pH 7.4
Gene ALDH9A1
Gene Accession No. NM_000696
Gene Alias ALDH4/ALDH7/ALDH9/E3/TMABADH
Gene Symbols ALDH9A1
Host Species Mouse
Immunogen ALDH9A1 (NP_000687, 173 a.a. ∼ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 223
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.