ALDOA, Mouse, Clone: 2E6, Abnova™

Catalog No.	Quantity
89-016-117	100 μg

Catalog No. 89-016-117 Supplier Abnova Corporation Supplier No. H00000226M03

Description

Mouse monoclonal antibody raised against a partial recombinant ALDOA.

This gene product, Aldolase A (fructose-bisphosphate aldolase) is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants which encode the same protein. [provided by RefSeq

Sequence: HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP

Specifications

• Antigen: ALDOA
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ALDOA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ALDOA
• Gene Accession No.: BC010660
• Gene Alias: ALDA/MGC10942/MGC17716/MGC17767
• Gene Symbols: ALDOA
• Host Species: Mouse
• Immunogen: ALDOA (AAH10660.1, 21 a.a. ∼ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 226
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ