Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016121

ALOX12B, Mouse, Clone: 3G12, Abnova™

Catalog No. 89016121 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-121 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-121 Supplier Abnova Corporation Supplier No. H00000242M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ALOX12B.

This gene encodes an enzyme involved in the converstion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma. [provided by RefSeq

Sequence: NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED

Specifications

Antigen ALOX12B
Applications ELISA
Classification Monoclonal
Clone 3G12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALOX12B.
Formulation PBS with no preservative; pH 7.4
Gene ALOX12B
Gene Accession No. NM_001139
Gene Alias 12R-LOX
Gene Symbols ALOX12B
Host Species Mouse
Immunogen ALOX12B (NP_001130, 171 a.a. ∼ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 242
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.