Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alkaline phosphatase, placental-like 2, Mouse, Clone: 2B3, Abnova™

Catalog No. 89014050 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-050 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-050 Supplier Abnova Corporation Supplier No. H00000251M07
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ALPPL2.

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue nonspecific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq

Sequence: SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE

Specifications

Antigen alkaline phosphatase, placental-like 2
Applications ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, KnockDown, Western Blot
Classification Monoclonal
Clone 2B3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALPPL2.
Formulation PBS with no preservative; pH 7.4
Gene ALPPL2
Gene Accession No. NM_031313
Gene Alias ALPG/ALPPL/GCAP
Gene Symbols ALPPL2
Host Species Mouse
Immunogen ALPPL2 (NP_112603, 365 a.a. ∼ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 251
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.