Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001421

ALX homeobox 3, Mouse, Clone: 1F1, Abnova™

Catalog No. 89001421 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-421 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-421 Supplier Abnova Corporation Supplier No. H00000257M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ALX3.

This gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors. [provided by RefSeq]

Sequence: KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG

Specifications

Antigen ALX homeobox 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1F1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ALX3.
Formulation ascites with no preservative
Gene ALX3
Gene Accession No. NM_006492
Gene Alias MGC138212/MGC141988
Gene Symbols ALX3
Host Species Mouse
Immunogen ALX3 (NP_006483, 150 a.a. ∼ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 257
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.