Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMELX, Mouse, Clone: 3B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMELX.

Manufacturer:  Abnova Corporation H00000265M03A

Catalog No. 89-016-135


  Check Availability
Add to cart

Specifications

Description

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Description & Specifications

Specifications

AMELX
3B5
Human
Ascites
AMELX
AIH1, ALGN, AMG, AMGL, AMGX
Murine
IgG2b, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
amelogenin (amelogenesis imperfecta 1, X-linked)
In ascites fluid
NM_001142
AMELX
AMELX (NP_001133, 93 a.a. ∽192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Human
Primary
265
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit