AMELX, Mouse, Clone: 3B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMELX.

Supplier:  Abnova Corporation H00000265M03A

Catalog No. 89-016-135

Description

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Specifications

• Antigen: AMELX
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_001142
• Gene Symbols: AMELX
• Immunogen: AMELX (NP_001133, 93 a.a. ∼ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 265
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3B5
• Description: Mouse monoclonal antibody raised against a partial recombinant AMELX.
• Gene: AMELX
• Gene Alias: AIH1/ALGN/AMG/AMGL/AMGX
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ