Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

adenosine monophosphate deaminase 2 (isoform L), Mouse, Clone: 2F5, Abnova™

Catalog No. 89000518 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-518 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-518 Supplier Abnova Corporation Supplier No. H00000271M01
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant AMPD2.

Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM

Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT

Specifications

Antigen adenosine monophosphate deaminase 2 (isoform L)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Formulation PBS with no preservative; pH 7.4
Gene AMPD2
Gene Accession No. NM_139156
Gene Symbols AMPD2
Host Species Mouse
Immunogen AMPD2 (NP_631895, 86 a.a. ∼ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 271
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.