AMY2B, Mouse, Clone: 2B12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AMY2B.

Supplier:  Abnova Corporation H00000280M01

Catalog No. 89-016-149

Description

Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq

Sequence: PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHM

Specifications

• Antigen: AMY2B
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020978
• Gene Symbols: AMY2B
• Immunogen: AMY2B (NP_066188, 19 a.a. ∼ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA
• Clone: 2B12
• Description: Mouse monoclonal antibody raised against a partial recombinant AMY2B.
• Gene: AMY2B
• Gene Alias: AMY2
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 280
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid