Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001239

ankyrin repeat domain 17, Mouse, Clone: 2B8, Abnova™

Catalog No. 89001239 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-239 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-239 Supplier Abnova Corporation Supplier No. H00026057M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ANKRD17.

This gene encodes a protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein is involved in liver development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG

Specifications

Antigen ankyrin repeat domain 17
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2B8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ANKRD17.
Formulation PBS with no preservative; pH 7.4
Gene ANKRD17
Gene Accession No. NM_032217
Gene Alias FLJ22206/GTAR/KIAA0697/NY-BR-16
Gene Symbols ANKRD17
Host Species Mouse
Immunogen ANKRD17 (NP_115593, 2501 a.a. ∼ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 26057
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.