ANPEP, Mouse, Clone: 1G1, Abnova™

Catalog No.	Quantity
89-016-151	100 μg

Catalog No. 89-016-151 Supplier Abnova Corporation Supplier No. H00000290M05

Description

Mouse monoclonal antibody raised against a partial recombinant ANPEP.

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq

Sequence: DATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK

Specifications

• Antigen: ANPEP
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ANPEP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ANPEP
• Gene Accession No.: BC058928
• Gene Alias: APN/CD13/LAP1/PEPN/gp150/p150
• Gene Symbols: ANPEP
• Host Species: Mouse
• Immunogen: ANPEP (AAH58928.1, 858 a.a. ∼ 967 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 290
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ