adaptor-related protein complex 1, mu 1 subunit, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AP1M1.

Manufacturer:  Abnova Corporation H00008907A01

Catalog No. 89-004-413

Description

The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq

Sequence: MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN

Specifications

• Antigen: adaptor-related protein complex 1, mu 1 subunit
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032493
• Gene Alias: AP47|CLAPM2|CLTNM|MU-1A
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 8907

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant AP1M1.
• Gene: AP1M1
• Format: Serum
• Gene Symbols: AP1M1
• Immunogen: AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human