AP2B1, Mouse, Clone: 2D5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AP2B1.

Supplier:  Abnova Corporation H00000163M01

Catalog No. 89-016-061

Description

The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG

Specifications

• Antigen: AP2B1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001282
• Gene Symbols: AP2B1
• Immunogen: AP2B1 (NP_001273.1, 585 a.a. ∼ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2D5
• Description: Mouse monoclonal antibody raised against a partial recombinant AP2B1.
• Gene: AP2B1
• Gene Alias: ADTB2/AP105B/AP2-BETA/CLAPB1/DKFZp781K0743
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 163
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid