adaptor-related protein complex 3, beta 1 subunit, Mouse, Clone: 3B4, Abnova™

Catalog No.	Quantity
89-001-089	100 μg

Catalog No. 89-001-089 Supplier Abnova Corporation Supplier No. H00008546M06

Description

Mouse monoclonal antibody raised against a partial recombinant AP3B1.

This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq

Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG

Specifications

• Antigen: adaptor-related protein complex 3, beta 1 subunit
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AP3B1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AP3B1
• Gene Accession No.: NM_003664
• Gene Alias: ADTB3/ADTB3A/HPS/HPS2/PE
• Gene Symbols: AP3B1
• Host Species: Mouse
• Immunogen: AP3B1 (NP_003655, 995 a.a. ∼ 1094 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8546
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ