Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

adaptor-related protein complex 3, beta 1 subunit, Mouse, Clone: 3B4, Abnova™

Catalog No. 89001089 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-089 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-089 Supplier Abnova Corporation Supplier No. H00008546M06
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant AP3B1.

This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. [provided by RefSeq

Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG

Specifications

Antigen adaptor-related protein complex 3, beta 1 subunit
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3B4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AP3B1.
Formulation PBS with no preservative; pH 7.4
Gene AP3B1
Gene Accession No. NM_003664
Gene Alias ADTB3/ADTB3A/HPS/HPS2/PE
Gene Symbols AP3B1
Host Species Mouse
Immunogen AP3B1 (NP_003655, 995 a.a. ∼ 1094 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 8546
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.