adaptor-related protein complex 4, beta 1 subunit, Mouse, Clone: 1B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant AP4B1.

Supplier:  Abnova Corporation H00010717M03

Catalog No. 89-001-191

Description

The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1; MIM 607243).[supplied by OMIM

Sequence: VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS

Specifications

• Antigen: adaptor-related protein complex 4, beta 1 subunit
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006594
• Gene Symbols: AP4B1
• Immunogen: AP4B1 (NP_006585, 640 a.a. ∼ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 10717
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA
• Clone: 1B2
• Description: Mouse monoclonal antibody raised against a partial recombinant AP4B1.
• Gene: AP4B1
• Gene Alias: BETA-4
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody