APCS, Mouse, Clone: 4E8, Abnova™

Catalog No.	Quantity
89-016-164	100 μg

Catalog No. 89-016-164 Supplier Abnova Corporation Supplier No. H00000325M07

Description

Mouse monoclonal antibody raised against a partial recombinant APCS.

The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq

Sequence: WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV

Specifications

• Antigen: APCS
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant APCS.
• Formulation: PBS with no preservative; pH 7.4
• Gene: APCS
• Gene Accession No.: NM_001639
• Gene Alias: MGC88159/PTX2/SAP
• Gene Symbols: APCS
• Host Species: Mouse
• Immunogen: APCS (NP_001630, 117 a.a. ∼ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 325
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ