APEX1, Mouse, Clone: 4D1, Abnova™

Catalog No.	Quantity
89-016-166	100 μg

Catalog No. 89-016-166 Supplier Abnova Corporation Supplier No. H00000328M02

Description

Mouse monoclonal antibody raised against a partial recombinant APEX1.

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq]

Sequence: DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Specifications

• Antigen: APEX1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant APEX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: APEX1
• Gene Accession No.: NM_001641
• Gene Alias: APE/APE-1/APE1/APEN/APEX/APX/HAP1/REF-1/REF1
• Gene Symbols: APEX1
• Host Species: Mouse
• Immunogen: APEX1 (NP_001632, 219 a.a. ∼ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 328
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ