apelin, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human APLN protein.

Supplier:  Abnova Corporation H00008862B01

Catalog No. 89-006-660

Description

Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM

Sequence: MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD

Specifications

• Antigen: apelin
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human APLN protein.
• Gene: APLN
• Gene Alias: XNPEP2
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC021104
• Gene Symbols: APLN
• Immunogen: APLN (AAH21104.1, 1 a.a. ∼ 122 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8862
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.