APOC4, Mouse, Clone: 3D10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant APOC4.

Manufacturer: Abnova Corporation H00000346M01

Catalog No. 89-016-177

  Check Availability
Add to Cart

    Specifications

    Antigen APOC4
    Applications Enzyme Linked Immunosorbent Assay,Immunoprecipitation,Sandwich ELISA,Western Blotting
    Clone 3D10
    Conjugate Unlabeled
    Cross Reactivity Human
    Description apolipoprotein C-IV
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene APOC4
    Gene Accession No. BC020723
    Gene Symbols APOC4
    Host Species Mouse
    Immunogen APOC4 (AAH20723, 27 a.a. ∽128 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 346

    Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3kb gene consisting of 3 exons and 2 introns; it is located 0.5kb 5' to the APOC2 gene. [provided by RefSeq

    Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit