Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016177

APOC4, Mouse, Clone: 3D10, Abnova™

Catalog No. 89016177 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-177 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-177 Supplier Abnova Corporation Supplier No. H00000346M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant APOC4.

Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3kb gene consisting of 3 exons and 2 introns; it is located 0.5kb 5' to the APOC2 gene. [provided by RefSeq]

Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Specifications

Antigen APOC4
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 3D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant APOC4.
Formulation PBS with no preservative; pH 7.4
Gene APOC4
Gene Accession No. BC020723
Gene Symbols APOC4
Host Species Mouse
Immunogen APOC4 (AAH20723.1, 27 a.a. ∼ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 346
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.