Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APOC4, Mouse, Clone: 3D10, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant APOC4.

Manufacturer:  Abnova Corporation H00000346M01

Catalog No. 89-016-177


  Check Availability
Add to cart

Specifications

Description

Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3kb gene consisting of 3 exons and 2 introns; it is located 0.5kb 5' to the APOC2 gene. [provided by RefSeq

Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Description & Specifications

Specifications

APOC4
3D10
apolipoprotein C-IV
APOC4
Liquid
Murine
IgG2a, κ
RUO
Primary
346
ELISA,Immunoprecipitation,Sandwich ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
BC020723
APOC4
APOC4 (AAH20723, 27 a.a. ∽128 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
100μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit