apolipoprotein H (beta-2-glycoprotein I), Mouse, Clone: 3F10, Abnova™

Catalog No.	Quantity
89-001-425	200 μL

Catalog No. 89-001-425 Supplier Abnova Corporation Supplier No. H00000350M01A

Description

Mouse monoclonal antibody raised against a partial recombinant APOH.

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq

Sequence: DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Specifications

• Antigen: apolipoprotein H (beta-2-glycoprotein I)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant APOH.
• Formulation: ascites with no preservative
• Gene: APOH
• Gene Accession No.: NM_000042
• Gene Alias: B2G1/BG
• Gene Symbols: APOH
• Host Species: Mouse
• Immunogen: APOH (NP_000033, 236 a.a. ∼ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 350
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ