Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

apolipoprotein H (beta-2-glycoprotein I), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89016716 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-716 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-716 Supplier Abnova Corporation Supplier No. H00000350B01P
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a full-length human APOH protein.

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq

Sequence: MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Specifications

Antigen apolipoprotein H (beta-2-glycoprotein I)
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human APOH protein.
Formulation PBS with no preservative; pH 7.4
Gene APOH
Gene Accession No. BC026283
Gene Alias B2G1/BG
Gene Symbols APOH
Host Species Mouse
Immunogen APOH (AAH26283.1, 1 a.a. ∼ 345 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 350
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.