apolipoprotein H (beta-2-glycoprotein I), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-716	50 μg

Catalog No. 89-016-716 Supplier Abnova Corporation Supplier No. H00000350B01P

Description

Mouse polyclonal antibody raised against a full-length human APOH protein.

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq

Sequence: MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Specifications

• Antigen: apolipoprotein H (beta-2-glycoprotein I)
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human APOH protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: APOH
• Gene Accession No.: BC026283
• Gene Alias: B2G1/BG
• Gene Symbols: APOH
• Host Species: Mouse
• Immunogen: APOH (AAH26283.1, 1 a.a. ∼ 345 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 350
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG