apolipoprotein M, Mouse, Clone: 2E5, Abnova™

Catalog No.	Quantity
89-001-318	100 μg

Catalog No. 89-001-318 Supplier Abnova Corporation Supplier No. H00055937M02

Description

Mouse monoclonal antibody raised against a full-length recombinant APOM.

The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. [provided by RefSeq

Sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Specifications

• Antigen: apolipoprotein M
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant APOM.
• Formulation: PBS with no preservative; pH 7.4
• Gene: APOM
• Gene Accession No.: BC020683
• Gene Alias: G3a/HSPC336/MGC22400/NG20
• Gene Symbols: APOM
• Host Species: Mouse
• Immunogen: APOM (AAH20683, 23 a.a. ∼ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55937
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ