adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-581	50 μL

Catalog No. 89-004-581 Supplier Abnova Corporation Supplier No. H00026060A01

Description

Mouse polyclonal antibody raised against a partial recombinant APPL.

The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq

Sequence: EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE

Specifications

• Antigen: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant APPL.
• Formulation: 50% glycerol
• Gene: APPL1
• Gene Accession No.: NM_012096
• Gene Alias: APPL/DIP13alpha
• Gene Symbols: APPL1
• Host Species: Mouse
• Immunogen: APPL (NP_036228, 611 a.a. ∼ 708 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26060
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum