adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant APPL.

Supplier:  Abnova Corporation H00026060A01

Catalog No. 89-004-581

Description

The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq

Sequence: EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE

Specifications

• Antigen: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant APPL.
• Gene: APPL1
• Gene Alias: APPL/DIP13alpha
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 26060
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_012096
• Gene Symbols: APPL1
• Immunogen: APPL (NP_036228, 611 a.a. ∼ 708 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Serum