Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AREG, Mouse, Clone: 3E4, Abnova™

Catalog No. 89016195 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-195 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-195 Supplier Abnova Corporation Supplier No. H00000374M06
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant AREG.

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype. [provided by RefSeq

Sequence: SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK

Specifications

Antigen AREG
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 3E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AREG.
Formulation PBS with no preservative; pH 7.4
Gene AREG
Gene Accession No. BC009799
Gene Alias AR/CRDGF/MGC13647/SDGF
Gene Symbols AREG
Host Species Mouse
Immunogen AREG (AAH09799, 20 a.a. ∼ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 374
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.